Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R305 (MIMI_R305)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R305 (MIMI_R305) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

Uncharacterized protein R305

UniProt

Q5UPY8

Expression Region

1-169

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNENFICNKYFVTILIIIIIILIVLLIVFLTKKNSRIERMENIDKLTFAEKPWSNTQDAD TYKIVDNDFDKYVDELTKLLGNKNRAKRKDEVYRDYIQSKPINKNNQQTKNTPTPLDDRP DLSQCQPCICPNDRYIPNSESSENDNHLDREIRKKISELGSYVKNKYKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp47 (SERPINH1) (NM_001235) Human Recombinant Protein
TP309847 20 µg

Hsp47 (SERPINH1) (NM_001235) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human IL-2
6560 5 µg

Recombinant Human IL-2

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS703804 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
DUSP11 (NM_003584) Human Over-expression Lysate
LC401192 20 µg

DUSP11 (NM_003584) Human Over-expression Lysate

Sign In for Pricing
View Details
MYADmL2 Human Gene Knockout Kit (CRISPR)
KN426719 1 Kit

MYADmL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Neurofilament (NF-L) (NFL/736), CF405S conjugate, 0.1mg/mL
BNC040736-500 1x 500 µL

Neurofilament (NF-L) (NFL/736), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details