Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L536 (MIMI_L536)
This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L536 (MIMI_L536) spans the amino acid sequence from region 1-169.
Product Specifications
Product Name Alternative
Uncharacterized protein L536
UniProt
Q5UQA0
Expression Region
1-169
Origin
Acanthamoeba polyphaga mimivirus (APMV)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MYGIYIHDELTINDTELSMDKLCSGIVENQSKCIAVSINSSNIISDLNMSVRKIIYKFGT NRYLFYYYNSKWYTDIHHILSLMDLSLGSFISELQKYYPECDLTMWILRGDGMCIHRKLI DLETMTKIILSFNSNFTRCFKAECIYHMAIVYILIMYQIYILSLIRINT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
G1041-121 5 mg
β-Galactosidase (Beta-galactosidase, Beta-gal, Lactase, LacZ, b0344, JW0335)
Sign In for Pricing
View Details 
ARP61946_P050-HRP 100 µL
AMY2B Antibody - N-terminal region : HRP (ARP61946_P050-HRP)
Sign In for Pricing
View Details 44484116 3x 1.0 µg
Smug1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details