Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L536 (MIMI_L536)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L536 (MIMI_L536) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

Uncharacterized protein L536

UniProt

Q5UQA0

Expression Region

1-169

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYGIYIHDELTINDTELSMDKLCSGIVENQSKCIAVSINSSNIISDLNMSVRKIIYKFGT NRYLFYYYNSKWYTDIHHILSLMDLSLGSFISELQKYYPECDLTMWILRGDGMCIHRKLI DLETMTKIILSFNSNFTRCFKAECIYHMAIVYILIMYQIYILSLIRINT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPY1-R Polyclonal Antibody
MBS2536630-01 0.02 mL

NPY1-R Polyclonal Antibody

Sign In for Pricing
View Details
NPY1-R Polyclonal Antibody
MBS2536630-02 0.06 mL

NPY1-R Polyclonal Antibody

Sign In for Pricing
View Details
NPY1-R Polyclonal Antibody
MBS2536630-03 0.12 mL

NPY1-R Polyclonal Antibody

Sign In for Pricing
View Details
NPY1-R Polyclonal Antibody
MBS2536630-04 0.2 mL

NPY1-R Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human ADAL sgRNA gene knockout kit - Lentiviral human ADAL sgRNA gene knockout kit (25)
GTR15369780 1 Vial

Lentiviral human ADAL sgRNA gene knockout kit - Lentiviral human ADAL sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
eEF1B-beta1 Antibody
PHY1274S 150 μg

eEF1B-beta1 Antibody

Sign In for Pricing
View Details