Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Caulobacter crescentus ATP synthase subunit b (atpF)

This Recombinant Caulobacter crescentus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q9AB66

Expression Region

1-169

Origin

Caulobacter crescentus (strain ATCC 19089 / CB15)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHQSLFSFSNPEFWVLAALVIFFGLLVVLKVLPGALFGALDGYAAKIKAELDEAQQLRE EAQALLADVKAQREDAERQAAAMLEAAKADAKRLAEEAKEKLEEQIKRRAEMAERKIAQA EAQAAADVKAAAVDLAAQAAETVLAARLAGAKGDTLVDAAIGQMGAKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERBB2 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2, neuro/glioblastoma Derived Oncogene Homolog (avian), CD340, HER-2, HER-2/neu, HER2, NEU, NGL, TKR1) (AP) discontinued
245806-AP 100 µL

ERBB2 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2, neuro/glioblastoma Derived Oncogene Homolog (avian), CD340, HER-2, HER-2/neu, HER2, NEU, NGL, TKR1) (AP) discontinued

Sign In for Pricing
View Details
GPR155 (NM_001033045) Human Tagged ORF Clone
RG220157 10 µg

GPR155 (NM_001033045) Human Tagged ORF Clone

Sign In for Pricing
View Details
COPS8
pro-983 5µg

COPS8

Sign In for Pricing
View Details
Human Sarcolipin (SLN) ELISA Kit
abx153017-01 96 Tests

Human Sarcolipin (SLN) ELISA Kit

Sign In for Pricing
View Details
Human Sarcolipin (SLN) ELISA Kit
abx153017-02 5x 96 Tests

Human Sarcolipin (SLN) ELISA Kit

Sign In for Pricing
View Details
Human Sarcolipin (SLN) ELISA Kit
abx153017-03 10x 96 Tests

Human Sarcolipin (SLN) ELISA Kit

Sign In for Pricing
View Details