Recombinant Lactobacillus acidophilus ATP synthase subunit b (atpF)
This Recombinant Lactobacillus acidophilus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
Q9RGY5
Expression Region
1-169
Origin
Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTIQTLFAASHHIYLGNAIWYLLCFAILMLLIKHYAWGPVSDMMEKRRQKIISDLDSAAS DRKKAETLANEREAALKNSRQEATQILSDAKTNAQNTSKEIVASANEDAAAIRKKANEEA AKAKSDALDAARDQVADISVAIAEKVIAKNLSAEDQKDLVDQFIKGLDD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880003-500 1x 500 µL
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details