Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides sp. ATP synthase subunit b (atpF)

This Recombinant Dehalococcoides sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A5FRQ1

Expression Region

1-169

Origin

Dehalococcoides sp. (strain BAV1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLAELGINIPSFIAQIVNFGLLLGLLYLFAYKPILAKLDERSTRIKESMERTDQVKEQ AQKAEEEFKKKIGEASQQGQLVIERAVKTGDEIRQKAIEEAKAEAEAMLSRARTEIRQER DEVVDQLRKEFAELTILAAGKVIDQSLDKKAHQALIDSVLENSTDLRKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen IV α2 Antibody
8C12196-AAT 50 µg

Collagen IV α2 Antibody

Sign In for Pricing
View Details
DOG-1 (DOG1.1), CF405S conjugate, 0.1mg/mL
BNC040725-500 1x 500 µL

DOG-1 (DOG1.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCNT2 Rabbit Polyclonal Antibody
TA365232 100 µL

GCNT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Stap1 Mouse Gene Knockout Kit (CRISPR)
KN516831 1 Kit

Stap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701273 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF568 conjugate, 0.1mg/mL
BNC681526-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details