Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides sp. ATP synthase subunit b (atpF)

This Recombinant Dehalococcoides sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A5FRQ1

Expression Region

1-169

Origin

Dehalococcoides sp. (strain BAV1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKLAELGINIPSFIAQIVNFGLLLGLLYLFAYKPILAKLDERSTRIKESMERTDQVKEQ AQKAEEEFKKKIGEASQQGQLVIERAVKTGDEIRQKAIEEAKAEAEAMLSRARTEIRQER DEVVDQLRKEFAELTILAAGKVIDQSLDKKAHQALIDSVLENSTDLRKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Cxcl2 Protein (Gst Tag)
PDER100112-01 20 µg

Recombinant Rat Cxcl2 Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Rat Cxcl2 Protein (Gst Tag)
PDER100112-02 100 µg

Recombinant Rat Cxcl2 Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Rat Cxcl2 Protein (Gst Tag)
PDER100112-03 500 µg

Recombinant Rat Cxcl2 Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Rat Cxcl2 Protein (Gst Tag)
PDER100112-04 1 mg

Recombinant Rat Cxcl2 Protein (Gst Tag)

Sign In for Pricing
View Details
Histiocytoma Marker (D11), CF647 conjugate, 0.1mg/mL
BNC470348-100 1x 100 µL

Histiocytoma Marker (D11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat gp130 Antibody Pair Set
E-KAB-0382 50 µL & 100 µg

Rat gp130 Antibody Pair Set

Sign In for Pricing
View Details