Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus helveticus ATP synthase subunit b (atpF)

This Recombinant Lactobacillus helveticus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A8YUJ7

Expression Region

1-169

Origin

Lactobacillus helveticus (strain DPC 4571)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIQTLFAASHHIYLGNALWYLICFAILLLLIKHFAWGPVSDMMEKRRQKVINDLDSAAS DRKKAETLANEREAALKNSRQEATQILSDAKANAQKTGKEIVASANEDAAAIRKKANEEA AKAKSDALDSARDQVADISLAIAEKVIAKNLSAEDQKDLVDQFIKELDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSX1 (NM_002448) Human Recombinant Protein
TP305682L 1 mg

MSX1 (NM_002448) Human Recombinant Protein

Sign In for Pricing
View Details
Rat Lecithin Cholesterol Acyltransferase (LCAT) ELISA Kit
RD-LCAT-Ra-01 96 Tests

Rat Lecithin Cholesterol Acyltransferase (LCAT) ELISA Kit

Sign In for Pricing
View Details
Rat Lecithin Cholesterol Acyltransferase (LCAT) ELISA Kit
RD-LCAT-Ra-02 48 Tests

Rat Lecithin Cholesterol Acyltransferase (LCAT) ELISA Kit

Sign In for Pricing
View Details
DAPP1 Human Gene Knockout Kit (CRISPR)
KN415474 1 Kit

DAPP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD64 (10.1), CF594 conjugate, 0.1mg/mL
BNC942846-100 1x 100 µL

CD64 (10.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Equine Procollagen II N-Terminal Propeptide (PIINP) ELISA Kit
RD-PIINP-Eq-01 96 Tests

Equine Procollagen II N-Terminal Propeptide (PIINP) ELISA Kit

Sign In for Pricing
View Details