Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B1H0B9

Expression Region

1-169

Origin

Uncultured termite group 1 bacterium phylotype Rs-D17

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIQKFGLEAKLFLFQLINFLIIVFILKKFLFAPLKKILDERKRKIEQSLQDAENAKIA LENASEKKKNILAKAKSSADTLMATVKVSIKETKEKAVIEAKQRSEQIIDEAKQKAATEF ESMNKKIGKISVDISGKVMSKVLSDLFTETEKQKLMSRALEKIDENIKN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Slingshot Homolog 3 ELISA Kit
MBS059030 Inquire

Cavy Slingshot Homolog 3 ELISA Kit

Sign In for Pricing
View Details
MAGED2 Recombinant Protein Antigen
NBP1-89413PEP 0.1 mL

MAGED2 Recombinant Protein Antigen

Sign In for Pricing
View Details
[Biotinyl-Gln1]-TCAP-2 / Teneurin C-terminal Associated Peptide-2 (Human)
B-020-18 20 µg

[Biotinyl-Gln1]-TCAP-2 / Teneurin C-terminal Associated Peptide-2 (Human)

Sign In for Pricing
View Details
OTS186935 100mg
A18632-100 100 mg

OTS186935 100mg

Sign In for Pricing
View Details
INPP1 Antibody, Biotin conjugated
A26335-100UG 100 µg

INPP1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
UROD (NM_000374) Human Recombinant Protein
TP300529L 1 mg

UROD (NM_000374) Human Recombinant Protein

Sign In for Pricing
View Details