Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B1H0B9

Expression Region

1-169

Origin

Uncultured termite group 1 bacterium phylotype Rs-D17

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIQKFGLEAKLFLFQLINFLIIVFILKKFLFAPLKKILDERKRKIEQSLQDAENAKIA LENASEKKKNILAKAKSSADTLMATVKVSIKETKEKAVIEAKQRSEQIIDEAKQKAATEF ESMNKKIGKISVDISGKVMSKVLSDLFTETEKQKLMSRALEKIDENIKN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Rhotekin, RTKN ELISA Kit
MBS9334250-01 48 Well

Human Rhotekin, RTKN ELISA Kit

Sign In for Pricing
View Details
Human Rhotekin, RTKN ELISA Kit
MBS9334250-02 96 Well

Human Rhotekin, RTKN ELISA Kit

Sign In for Pricing
View Details
Human Rhotekin, RTKN ELISA Kit
MBS9334250-03 5x 96 Well

Human Rhotekin, RTKN ELISA Kit

Sign In for Pricing
View Details
Human Rhotekin, RTKN ELISA Kit
MBS9334250-04 10x 96 Well

Human Rhotekin, RTKN ELISA Kit

Sign In for Pricing
View Details
Histone H2B Mouse Monoclonal Antibody
AMM85023-01 1 Each

Histone H2B Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Histone H2B Mouse Monoclonal Antibody
AMM85023-02 50 µL

Histone H2B Mouse Monoclonal Antibody

Sign In for Pricing
View Details