Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B1H0B9

Expression Region

1-169

Origin

Uncultured termite group 1 bacterium phylotype Rs-D17

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIQKFGLEAKLFLFQLINFLIIVFILKKFLFAPLKKILDERKRKIEQSLQDAENAKIA LENASEKKKNILAKAKSSADTLMATVKVSIKETKEKAVIEAKQRSEQIIDEAKQKAATEF ESMNKKIGKISVDISGKVMSKVLSDLFTETEKQKLMSRALEKIDENIKN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS11 Antibody
orb677857 100 µL

DHRS11 Antibody

Sign In for Pricing
View Details
PWWP2A (NM_001130864) Human Tagged Lenti ORF Clone
RC226141L2 10 µg

PWWP2A (NM_001130864) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ELISA Kit For Disintegrin and metalloproteinase domain-containing protein 9
E1829h 96 Tests

ELISA Kit For Disintegrin and metalloproteinase domain-containing protein 9

Sign In for Pricing
View Details
FBXW23 shRNA Plasmid (m)
sc-148809-SH 20 µg

FBXW23 shRNA Plasmid (m)

Sign In for Pricing
View Details
1- (2,6-Difluorophenyl) ethane-1,2-diamine dihydrochloride
UGD92743-01 50 mg

1- (2,6-Difluorophenyl) ethane-1,2-diamine dihydrochloride

Sign In for Pricing
View Details
1- (2,6-Difluorophenyl) ethane-1,2-diamine dihydrochloride
UGD92743-02 0.5 g

1- (2,6-Difluorophenyl) ethane-1,2-diamine dihydrochloride

Sign In for Pricing
View Details