Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heliobacterium modesticaldum ATP synthase subunit b (atpF)

This Recombinant Heliobacterium modesticaldum ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B0TI54

Expression Region

1-169

Origin

Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLESVLHALHLNETFLAMLISFLILVFILQQVAFKPILKALDERRQKVEESISRAENDLE EANRMRAENAAELAKARQEAHDLIARATKVGEEKAQEIVAAAQAEANRLKEKAVADIQRE KEKALEELRSHVVNLSILAAEKVIRKNLDEPTQRQLVDEVINEVGKLPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UAP56 Rabbit monoclonal antibody
BS41092 50ul

UAP56 Rabbit monoclonal antibody

Sign In for Pricing
View Details
MAF Adenovirus (Mouse)
27897054 1.0 mL

MAF Adenovirus (Mouse)

Sign In for Pricing
View Details
LAP3 Protein Vector (Human) (pPM-C-HA)
26297021 500 ng

LAP3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human soluble vascular adhesion protein-1 (sVAP-1) ELISA Kit
201-12-2134 96 Tests

Human soluble vascular adhesion protein-1 (sVAP-1) ELISA Kit

Sign In for Pricing
View Details
Canine malonyl coenzyme A (Mal CoA) ELISA Kit
EIA07104Ca 1 Kit

Canine malonyl coenzyme A (Mal CoA) ELISA Kit

Sign In for Pricing
View Details
Btnl1 Mouse Gene Knockout Kit (CRISPR)
KN502314 1 Kit

Btnl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details