Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heliobacterium modesticaldum ATP synthase subunit b (atpF)

This Recombinant Heliobacterium modesticaldum ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B0TI54

Expression Region

1-169

Origin

Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLESVLHALHLNETFLAMLISFLILVFILQQVAFKPILKALDERRQKVEESISRAENDLE EANRMRAENAAELAKARQEAHDLIARATKVGEEKAQEIVAAAQAEANRLKEKAVADIQRE KEKALEELRSHVVNLSILAAEKVIRKNLDEPTQRQLVDEVINEVGKLPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAI3 Protein Vector (Human) (pPM-N-D-C-HA)
PV326192 500 ng

BAI3 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
USP9X (Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM)
253337 100 µg

USP9X (Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM)

Sign In for Pricing
View Details
9930111J21Rik1 CRISPR Activation Plasmid (m)
sc-437111-ACT 20 µg

9930111J21Rik1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Cdc25C Rabbit pAb
E47R9597 100 µL

Cdc25C Rabbit pAb

Sign In for Pricing
View Details
Antitumor agent-150
T209608-01 10 mg

Antitumor agent-150

Sign In for Pricing
View Details
Antitumor agent-150
T209608-02 50 mg

Antitumor agent-150

Sign In for Pricing
View Details