Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019)

This Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

Uncharacterized protein BB_0019

UniProt

O51051

Expression Region

1-170

Origin

Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIVSLLLLFSVLNVYSNSLDYFKSNFNYLKLSDAKSLPLQDKSTSSGNFVSHKKNNNMS VADNDDSFLYKNIQENKALNLENDLESKSAKDFFRFSAISIGSFPIVLFLSLFFFDVSYY FYSGMNANYVPYPFSNGPSFSKDEIYKKFIVSASIGAIVALTIALLDYFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-500 1x 500 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-500 1x 500 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details