Recombinant Clostridium botulinum UPF0316 protein CLK_3798 (CLK_3798)
This Recombinant Clostridium botulinum UPF0316 protein CLK_3798 (CLK_3798) spans the amino acid sequence from region 1-170.
Product Specifications
Product Name Alternative
UPF0316 protein CLK_3798
UniProt
B1KVR4
Expression Region
1-170
Origin
Clostridium botulinum (strain Loch Maree / Type A3)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401803-500 1x 500 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470818-500 1x 500 µL
CD45RA (PTPRC/818), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details