Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-170.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
Q2JTN9
Expression Region
1-170
Origin
Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPVSKQVIATEAITRKVDLDNPKVLAKLKKNMGHMTYGEPAWPNDLLFMFPVVILGTIGV IVGLAVMDPAGVGEPADPFATPLEILPEWYLYPAFHILRIAPNKLLGIALMSAIPVGLLF VPFIENVNKFQNPLRRPVATTVFLIGTLVTLYLGIGATLPLDKWVTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740523-500 1x 500 µL
AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC422645 20 µg
KIR2DL5B (NM_001018081) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC742057-100 1x 100 µL
HPV-16 (Human Papilloma Virus 16) (rHPV16L1/1058), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 