Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q2JL31

Expression Region

1-170

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVSKQVIATEAITRKVDLDNPKVVAKLKKNMGHMTYGEPAWPNDLLFMFPVVILGTIGV IVGLSVMDPAGVGEPADPFATPLEILPEWYLYPAFHILRIAPNKLLGIALMSAIPVGLLF VPFIENVNKFQNPLRRPVATTVFLIGTLVTLYLGIGATLPLDKWVTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAVL1 Human Gene Knockout Kit (CRISPR)
KN201562BN 1 Kit

ELAVL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAAP100 Polyclonal Antibody
E-AB-19883-01 20 µL

FAAP100 Polyclonal Antibody

Sign In for Pricing
View Details
FAAP100 Polyclonal Antibody
E-AB-19883-02 60 µL

FAAP100 Polyclonal Antibody

Sign In for Pricing
View Details
FAAP100 Polyclonal Antibody
E-AB-19883-03 120 µL

FAAP100 Polyclonal Antibody

Sign In for Pricing
View Details
FAAP100 Polyclonal Antibody
E-AB-19883-04 200 µL

FAAP100 Polyclonal Antibody

Sign In for Pricing
View Details
Oxyclozanide
TRC-O870640-250MG 250 mg

Oxyclozanide

Sign In for Pricing
View Details