Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF)

This Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q318T9

Expression Region

1-170

Origin

Prochlorococcus marinus (strain MIT 9312)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTLLATEGFGLNFNLFETNILNWAVVVFGLYKFLPSFLGKMLQKRREGILLELKDAED RLVNATKALDKAKKDLSSAEEKASQIKADSFKRSESIRMESEKKAIEEMARIKQSAISDE SSEASRAISQLRKEAVELAIKKALDSLPNRLDSTTQENLVTQSINNIEVN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam54a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4662107 1.0 µg DNA

Fam54a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
WASF3 Antibody, HRP conjugated
MBS7106342-01 0.05 mg

WASF3 Antibody, HRP conjugated

Sign In for Pricing
View Details
WASF3 Antibody, HRP conjugated
MBS7106342-02 0.1 mg

WASF3 Antibody, HRP conjugated

Sign In for Pricing
View Details
WASF3 Antibody, HRP conjugated
MBS7106342-03 5x 0.1 mg

WASF3 Antibody, HRP conjugated

Sign In for Pricing
View Details
Cdc42ep2 Mouse shRNA Plasmid (Locus ID 104252)
TL505693 1 Kit

Cdc42ep2 Mouse shRNA Plasmid (Locus ID 104252)

Sign In for Pricing
View Details
SSTR3 Conjugated Antibody
MBS9447701-01 0.1 mL (Biotin)

SSTR3 Conjugated Antibody

Sign In for Pricing
View Details