Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF)

This Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q318T9

Expression Region

1-170

Origin

Prochlorococcus marinus (strain MIT 9312)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTLLATEGFGLNFNLFETNILNWAVVVFGLYKFLPSFLGKMLQKRREGILLELKDAED RLVNATKALDKAKKDLSSAEEKASQIKADSFKRSESIRMESEKKAIEEMARIKQSAISDE SSEASRAISQLRKEAVELAIKKALDSLPNRLDSTTQENLVTQSINNIEVN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SLC6A6 shRNA Plasmid
abx972996-01 150 µg

Mouse SLC6A6 shRNA Plasmid

Sign In for Pricing
View Details
Mouse SLC6A6 shRNA Plasmid
abx972996-02 300 µg

Mouse SLC6A6 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal EAAT1/GLAST-1/SLC1A3 Antibody [FITC]
NBP2-98747F 0.1 mL

Rabbit Polyclonal EAAT1/GLAST-1/SLC1A3 Antibody [FITC]

Sign In for Pricing
View Details
Sdu1 Antibody
orb856147 2 mg

Sdu1 Antibody

Sign In for Pricing
View Details
APC/XFD750 Anti-human CD3 Antibody *UCHT1*
100321E1-AAT 100 Tests

APC/XFD750 Anti-human CD3 Antibody *UCHT1*

Sign In for Pricing
View Details
Human Cytochrome C oxidase 17 (COX17) ELISA Kit
YP-W18382-01 48 Tests

Human Cytochrome C oxidase 17 (COX17) ELISA Kit

Sign In for Pricing
View Details