Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF)

This Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q318T9

Expression Region

1-170

Origin

Prochlorococcus marinus (strain MIT 9312)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLTLLATEGFGLNFNLFETNILNWAVVVFGLYKFLPSFLGKMLQKRREGILLELKDAED RLVNATKALDKAKKDLSSAEEKASQIKADSFKRSESIRMESEKKAIEEMARIKQSAISDE SSEASRAISQLRKEAVELAIKKALDSLPNRLDSTTQENLVTQSINNIEVN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fgfr4 3'UTR Luciferase Stable Cell Line
TU204622 1.0 mL

Fgfr4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Olr1063 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7171505 3x 1.0 µg

Olr1063 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
BCAM Rabbit Polyclonal Antibody
orb1545666-01 50 μL

BCAM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCAM Rabbit Polyclonal Antibody
orb1545666-02 100 µL

BCAM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NPC2 (NM_006432) Human Tagged ORF Clone Lentiviral Particle
RC200282L2V 200 µL

NPC2 (NM_006432) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TRNAE14 ORF Vector (Human) (pORF)
ORF034649 1.0 µg DNA

TRNAE14 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details