Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0129 (MJ0129)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0129 (MJ0129) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0129

UniProt

Q57593

Expression Region

1-170

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSFVVMSFLIFVIVMVNEHKAHLSVIQKMILAVVNGSITIILSIIVFYIFYPQNISLFL ITAGILTVFVFLYGLLLFLFGFTHRELSYLSKYDKYKFLCKFTIEMFSSLTNHAFLTISA IVLYQIQHPKPTIDFIVMIGMITISVIVVMLLFLKTYSIIIKQLKKLENN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 19 (IL-19) ELISA Kit
MBS3800339-01 48 Well

Human Interleukin 19 (IL-19) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 19 (IL-19) ELISA Kit
MBS3800339-02 96 Well

Human Interleukin 19 (IL-19) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 19 (IL-19) ELISA Kit
MBS3800339-03 5x 96 Well

Human Interleukin 19 (IL-19) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 19 (IL-19) ELISA Kit
MBS3800339-04 10x 96 Well

Human Interleukin 19 (IL-19) ELISA Kit

Sign In for Pricing
View Details
Lrp5 Mouse siRNA Oligo Duplex (Locus ID 16973)
SR423069 1 Kit

Lrp5 Mouse siRNA Oligo Duplex (Locus ID 16973)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. C-phycocyanin-1 alpha chain (cpcA1)
MBS1052629-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. C-phycocyanin-1 alpha chain (cpcA1)

Sign In for Pricing
View Details