Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nymphaea alba Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Nymphaea alba Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

Q6EW21

Expression Region

1-170

Origin

Nymphaea alba (White water-lily) (Castalia alba)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLFQIQIDLEILR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dnmt2 (TRDMT1) Human Gene Knockout Kit (CRISPR)
KN208363 1 Kit

Dnmt2 (TRDMT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PACAP (ADCYAP1) (NM_001117) Human Over-expression Lysate
LY400450 100 µg

PACAP (ADCYAP1) (NM_001117) Human Over-expression Lysate

Sign In for Pricing
View Details
2,4-Dihydroxybenzaldehyde
TRC-D450995-25G 25 g

2,4-Dihydroxybenzaldehyde

Sign In for Pricing
View Details
(+)-Alpha-Cyperone
TRC-C989595-10MG 10 mg

(+)-Alpha-Cyperone

Sign In for Pricing
View Details
JMJD7 (NM_001114632) Human Over-expression Lysate
LY426498 100 µg

JMJD7 (NM_001114632) Human Over-expression Lysate

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), CF568 conjugate, 0.1mg/mL
BNC683256-500 1x 500 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details