Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b (atpF)

This Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q7V035

Expression Region

1-170

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLPLLATEGFGLNLNLFETNVLNWAVVVFGLYKFLPGFLGKMLQKRREGILLELKDAED RLLKATQALEKAKTDLSLAEEKAGQIKADSLKRSESIRMESEKKAIEEMARIKQSAISDE SSEASRAISQLRKEAVELAIKKALDSLPNRLDQTTQENLVTQSINNIEMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)
MBS1328171-01 0.05 mg (E-Coli)

Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)

Sign In for Pricing
View Details
Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)
MBS1328171-02 0.05 mg (Yeast)

Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)

Sign In for Pricing
View Details
Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)
MBS1328171-03 0.05 mg (Baculovirus)

Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)

Sign In for Pricing
View Details
Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)
MBS1328171-04 0.2 mg (E-Coli)

Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)

Sign In for Pricing
View Details
Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)
MBS1328171-05 0.5 mg (E-Coli)

Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)

Sign In for Pricing
View Details
Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)
MBS1328171-06 0.2 mg (Yeast)

Recombinant Pyrococcus kodakaraensis Ornithine carbamoyltransferase (argF)

Sign In for Pricing
View Details