Recombinant Human AP20 region protein 1 (APRG1)
This Recombinant Human AP20 region protein 1 (APRG1) spans the amino acid sequence from region 1-170.
Product Specifications
Product Name Alternative
AP20 region protein 1
UniProt
Q8IVJ8
Expression Region
1-170
Origin
Homo sapiens (Human)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKTMATRKRCKLSRTGPEFENVIKRLLCARTFHTRIGGDLTHGIINRGRRANAEQMGLQG SAQHFNIFPLDLWTQGKKTEVQKREGTDSIPAAGRSGTANQPSIAPHRCLFSRGITALDG LKRGRGCNGAAHLVRGDAWKTKLGEPWVSIALALAGPGAILILELSWFLG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741060-500 1x 500 µL
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681777-500 1x 500 µL
Prostate Specific Antigen (PSA) (3E6), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042094-500 1x 500 µL
P53 Tumor Suppressor Protein (rBP53-12), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details