Recombinant Human TM2 domain-containing protein 1 (TM2D1)
This Recombinant Human TM2 domain-containing protein 1 (TM2D1) spans the amino acid sequence from region 38-207.
Product Specifications
Product Name Alternative
TM2 domain-containing protein 1, Beta-amyloid-binding protein, hBBP
UniProt
Q9BX74
Expression Region
38-207
Origin
Homo sapiens (Human)
Field of Research
Musculoskeletal & Connective Tissue Research; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
TSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNE THFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFC GIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
307462 100 µL
B3GALT1 (Beta-1,3-galactosyltransferase 1, Beta-1,3-GalTase 1, Beta3Gal-T1, Beta3GalT1, 241-, UDP-galactose: beta-N-acetyl-glucosamine-beta-1,3-galactosyltransferase 1, B3GALT1)
Sign In for Pricing
View Details 
10423114 3x 1.0 µg
2410002O22Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 
VAng-Lsx08527-50gEcoli 50 µg (E. coli)
Recombinant Shigella Boydii aes Protein (aa 1-319) (strain Sb227)
Sign In for Pricing
View Details 