Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis ATP synthase subunit b (atpF)

This Recombinant Bacillus subtilis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

P37814

Expression Region

1-170

Origin

Bacillus subtilis (strain 168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQLPLELGLSFNGGDILFQLLAMLILLALLKKYALGPLLNIMKQREDHIAGEITSAEEK NKEAQQLIEEQRVLLKEARQESQTLIENAKKLGEKQKEEIIQAARAESERLKEAARTEIV KEKEQAVSALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEVGESR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACCN5 (ASIC5) (NM_017419) Human Recombinant Protein
TP323871L 1 mg

ACCN5 (ASIC5) (NM_017419) Human Recombinant Protein

Sign In for Pricing
View Details
Human N acetylglucosamine kinase (NAGK) activation kit by CRISPRa
GA110799 1 Kit

Human N acetylglucosamine kinase (NAGK) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human Coagulation Factor IX/F9 Protein (His Tag)
PKSH032264-01 10 µg

Recombinant Human Coagulation Factor IX/F9 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Coagulation Factor IX/F9 Protein (His Tag)
PKSH032264-02 50 µg

Recombinant Human Coagulation Factor IX/F9 Protein (His Tag)

Sign In for Pricing
View Details
Fungal Growth Incubator BIFG-103
BIFG-103 1 Unit

Fungal Growth Incubator BIFG-103

Sign In for Pricing
View Details
CD68 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10H10]
TA802964BM 100 µL

CD68 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10H10]

Sign In for Pricing
View Details