Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

P45827

Expression Region

1-170

Origin

Mycobacterium leprae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEVSAIVFAVSQAAEEGKSSNFLLPNGTFFFVLAIFLVVLGVIGTFVVPPILKVLQERD AMVAKTDADSKMSAAQFAAAQADYEAAMKEARVQSSFLRDNARVDGRKSIEEARVRAEQH VVSTLQIAGEQIKRERDAVELDLRAKAGAMSLILASRILGVDITASVVTR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDPN Antibody
40308 100 µL

PDPN Antibody

Sign In for Pricing
View Details
Recombinant Human SPARC protein (SPARC) (Active)
CSB-AP000311HU-01 10 µg

Recombinant Human SPARC protein (SPARC) (Active)

Sign In for Pricing
View Details
Recombinant Human SPARC protein (SPARC) (Active)
CSB-AP000311HU-02 100 µg

Recombinant Human SPARC protein (SPARC) (Active)

Sign In for Pricing
View Details
Recombinant Human SPARC protein (SPARC) (Active)
CSB-AP000311HU-03 500 µg

Recombinant Human SPARC protein (SPARC) (Active)

Sign In for Pricing
View Details
Human OR6A2 full length protein-synthetic nanodisc
MBS1880170-01 0.01 mg

Human OR6A2 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human OR6A2 full length protein-synthetic nanodisc
MBS1880170-02 0.05 mg

Human OR6A2 full length protein-synthetic nanodisc

Sign In for Pricing
View Details