What is the catalog number for Recombinant ATP synthase subunit b (atpF)?

The catalog number for Recombinant ATP synthase subunit b (atpF) is orb2930697.

What sizes are available for Recombinant ATP synthase subunit b (atpF)?

Recombinant ATP synthase subunit b (atpF) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant ATP synthase subunit b (atpF) come in?

Recombinant ATP synthase subunit b (atpF) is available in 2 different pack sizes.

Is Recombinant ATP synthase subunit b (atpF) in stock?

Recombinant ATP synthase subunit b (atpF) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

P45827

Expression Region

1-170

Origin

Mycobacterium leprae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEVSAIVFAVSQAAEEGKSSNFLLPNGTFFFVLAIFLVVLGVIGTFVVPPILKVLQERD AMVAKTDADSKMSAAQFAAAQADYEAAMKEARVQSSFLRDNARVDGRKSIEEARVRAEQH VVSTLQIAGEQIKRERDAVELDLRAKAGAMSLILASRILGVDITASVVTR