Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF)

This Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A2BYH8

Expression Region

1-170

Origin

Prochlorococcus marinus (strain MIT 9515)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLPLLATEGFGLNLNLFETNVLNWAVVVFGLYKFLPSFLGKMLQKRREGILLELKDAED RLLKATQALEKAKTDLSLAEEKASQIKADSLKRSESIRMESEKKAIEEMARIKQSAISDE SSEASRAISQLRKEAVELAIKKALDSLPNRLDQTTQENLVTQSINNIEMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2C18 siRNA (Human)
orb1867157-01 15 nmol

CYP2C18 siRNA (Human)

Sign In for Pricing
View Details
CYP2C18 siRNA (Human)
orb1867157-02 30 nmol

CYP2C18 siRNA (Human)

Sign In for Pricing
View Details
Bisindolylmaleimide V (Ro 31-6045, BIM V)
MBS6050068-01 1 mg

Bisindolylmaleimide V (Ro 31-6045, BIM V)

Sign In for Pricing
View Details
Bisindolylmaleimide V (Ro 31-6045, BIM V)
MBS6050068-02 5 mg

Bisindolylmaleimide V (Ro 31-6045, BIM V)

Sign In for Pricing
View Details
Bisindolylmaleimide V (Ro 31-6045, BIM V)
MBS6050068-03 5x 5 mg

Bisindolylmaleimide V (Ro 31-6045, BIM V)

Sign In for Pricing
View Details
Rat Nphs2 (Podocin) ELISA Kit
MBS7615290-01 48 Well

Rat Nphs2 (Podocin) ELISA Kit

Sign In for Pricing
View Details