Recombinant Saccharomyces cerevisiae Protein ECM34 (ECM34)
This Recombinant Saccharomyces cerevisiae Protein ECM34 (ECM34) spans the amino acid sequence from region 1-170.
Product Specifications
Product Name Alternative
Protein ECM34, Extracellular mutant protein 34
UniProt
P38728
Expression Region
1-170
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEGRKSEDEKNEAALACDVFESSNAKLPKNVFRSSFTWYCYEVINRSAFHIWLLLCLTLI VGWKVFSGIGGRRPSDSNMDGPQTKHKRNPGFLRRHSTIVILVISLAVSFSWEAFKMYRE RTFGKQITQFAKEIIKSAPSTDMESWDRVAADFNSYMYENKLWNTEYFFC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942345-100 1x 100 µL
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680492-100 1x 100 µL
Moesin (MSN/492), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details