Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Exiguobacterium sp. UPF0316 protein EAT1b_0871 (EAT1b_0871)

This Recombinant Exiguobacterium sp. UPF0316 protein EAT1b_0871 (EAT1b_0871) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

UPF0316 protein EAT1b_0871

UniProt

C4L5I5

Expression Region

1-171

Origin

Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQILLILLLQLIYVPVLTLRTIMLVKGKTVIAGLFGTLETLIYIFALGIVFQDLTTVGM IVYAVGFGLGILLGGFVERKLAIGYNMIQVHTKEYPAELIQQMRDNGYGVTHYQGQGRDG VRYRLDVLAARTRMKELRELVEKHEPKAFLVAFDPIDFKGGYMMKGLRRPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-500 1x 500 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PTPRC/1147), CF594 conjugate, 0.1mg/mL
BNC941147-500 1x 500 µL

CD45RB (PTPRC/1147), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF568 conjugate, 0.1mg/mL
BNC680764-100 1x 100 µL

CD79a (IGA/764), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF405S conjugate, 0.1mg/mL
BNC040385-500 1x 500 µL

CD3e (Rabbit PAb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details