Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Mitoferrin-1 (SLC25A37)

This Recombinant Bovine Mitoferrin-1 (SLC25A37) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

Mitoferrin-1, Mitochondrial iron transporter 1, Solute carrier family 25 member 37

UniProt

Q3ZBJ8

Expression Region

1-171

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELRRGGVGSQARARRMDGDSRDGGGGCKDAGSEDYENLPTSASLSTHMTAGAMAGILEH SVMYPVDSVKTRMQSLNPDPKAHYTSVYGALKKIIRTEGFWRPLRGLNVMMMGAGPAHAM YFACYENMKRTLNAVFHHQGNSHLANGICKRLSGVRKVSPSTDPSPGFSSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCB 101-13C12
TRC-P216628-0.5MG 0.5 mg

PCB 101-13C12

Sign In for Pricing
View Details
CD34 (HPCA1/763), 0.2mg/mL
BNUB0763-500 1x 500 µL

CD34 (HPCA1/763), 0.2mg/mL

Sign In for Pricing
View Details
4-Nitrophenylacetonitrile
TRC-N502380-10G 10 g

4-Nitrophenylacetonitrile

Sign In for Pricing
View Details
Hifair™ IV Reverse Transcriptase
11112ES92 10000 U

Hifair™ IV Reverse Transcriptase

Sign In for Pricing
View Details
ABRAXAS2 Antibody
KC-1396-01 50 μL

ABRAXAS2 Antibody

Sign In for Pricing
View Details
ABRAXAS2 Antibody
KC-1396-02 100 µL

ABRAXAS2 Antibody

Sign In for Pricing
View Details