Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis ATP synthase subunit b (atpF)

This Recombinant Staphylococcus epidermidis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q5HMB5

Expression Region

1-171

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATANTFILGAGVEWGTTFVTLVTFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAE QAKINAQKLEEENRKTLKETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSE INSQKERAISDINNQVSELSVLIASKVLRKEISEQDQKELVEKYLKEAGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Na-Z-L-histidine 99+%
240728-01 5 g

Na-Z-L-histidine 99+%

Sign In for Pricing
View Details
Na-Z-L-histidine 99+%
240728-02 25 g

Na-Z-L-histidine 99+%

Sign In for Pricing
View Details
Na-Z-L-histidine 99+%
240728-03 100 g

Na-Z-L-histidine 99+%

Sign In for Pricing
View Details
Na-Z-L-histidine 99+%
240728-04 250 g

Na-Z-L-histidine 99+%

Sign In for Pricing
View Details
M. tuberculosis Rv2623 dormant protein Monoclonal Antibodies
VACY-1022-CY816 Each

M. tuberculosis Rv2623 dormant protein Monoclonal Antibodies

Sign In for Pricing
View Details
Lambda Light Chain Antibody FITC Conjugated
orb1542323 100 µL

Lambda Light Chain Antibody FITC Conjugated

Sign In for Pricing
View Details