Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis ATP synthase subunit b (atpF)

This Recombinant Staphylococcus epidermidis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q5HMB5

Expression Region

1-171

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATANTFILGAGVEWGTTFVTLVTFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAE QAKINAQKLEEENRKTLKETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSE INSQKERAISDINNQVSELSVLIASKVLRKEISEQDQKELVEKYLKEAGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Angiopoietin 1 (ANGPT1) ELISA Kit
RDR-ANGPT1-c-96Tests 96 Tests

Canine Angiopoietin 1 (ANGPT1) ELISA Kit

Sign In for Pricing
View Details
ZNF566 Antibody
55-257 400 µL

ZNF566 Antibody

Sign In for Pricing
View Details
KCNH8 Human Gene Knockout Kit (CRISPR)
KN412154 1 Kit

KCNH8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pallidin (BLOC1S6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E2]
TA504156BM 100 µL

Pallidin (BLOC1S6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E2]

Sign In for Pricing
View Details
Anti-RUNX1/AML1 Antibody Picoband® (Dylight550 Conjugate)
PB9157-Dylight550 100 µg

Anti-RUNX1/AML1 Antibody Picoband® (Dylight550 Conjugate)

Sign In for Pricing
View Details
OR6E1P Protein Lysate (Human) with C-Ha Tag
35509031 100 µg

OR6E1P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details