Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TM2 domain-containing protein 1 (Tm2d1)

This Recombinant Mouse TM2 domain-containing protein 1 (Tm2d1) spans the amino acid sequence from region 38-208.

Product Specifications

Product Name Alternative

TM2 domain-containing protein 1, Beta-amyloid-binding protein, mBBP

UniProt

Q99MB3

Expression Region

38-208

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGAVGGEETPKCEDLRVGQYICKEPKINDATQEPVNCTNYTAHVQCFPAPKITCKDLSGN ETHFTGSEVGFLKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGF CGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC10 Rabbit pAb
A6777-01 20 µL

TRAPPC10 Rabbit pAb

Sign In for Pricing
View Details
TRAPPC10 Rabbit pAb
A6777-02 100 μL

TRAPPC10 Rabbit pAb

Sign In for Pricing
View Details
TRAPPC10 Rabbit pAb
A6777-03 500 μL

TRAPPC10 Rabbit pAb

Sign In for Pricing
View Details
TRAPPC10 Rabbit pAb
A6777-04 1000 μL

TRAPPC10 Rabbit pAb

Sign In for Pricing
View Details
ent-Lurasidone-D8 Hydrochloride
TRC-L474942-100MG 100 mg

ent-Lurasidone-D8 Hydrochloride

Sign In for Pricing
View Details
UBC Antibody
orb1249844 200 µL

UBC Antibody

Sign In for Pricing
View Details