Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus brevis ATP synthase subunit b (atpF)

This Recombinant Lactobacillus brevis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q03QY4

Expression Region

1-171

Origin

Lactobacillus brevis (strain ATCC 367 / JCM 1170)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSHLVVGQGLYYGDSIFYAVCFLLLMWIIKVLAWKPVTKMMQDRADKISNDIDSAEKSR NDAAELVQKRQAALASSRSEAQTIVNDAKANGQQQREQIVTQAQADVQTLKQNAQKDIEQ ERQDALSNARNYVADLSIEIASKIIQRELKADDQKALIDSYIEGLGKQHES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMPRSS13 activation kit by CRISPRa
GA113336 1 Kit

Human TMPRSS13 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS713368 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CD13 / Aminopeptidase-N (Myeloid Cell Marker) (APN/1464), CF740 conjugate, 0.1mg/mL
BNC741464-500 1x 500 µL

CD13 / Aminopeptidase-N (Myeloid Cell Marker) (APN/1464), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL 6 Human
OM296532-01 20 µg

IL 6 Human

Sign In for Pricing
View Details
IL 6 Human
OM296532-02 5 µg

IL 6 Human

Sign In for Pricing
View Details
IL 6 Human
OM296532-03 1 mg

IL 6 Human

Sign In for Pricing
View Details