Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis ATP synthase subunit b (atpF)

This Recombinant Mycobacterium bovis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A1KI94

Expression Region

1-171

Origin

Mycobacterium bovis (strain BCG / Pasteur 1173P2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEVSAIVLAASQAAEEGGESSNFLIPNGTFFVVLAIFLVVLAVIGTFVVPPILKVLRER DAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARADGRKVIEDARVRAEQ QVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGVDLTASAATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL31 Antibody
KC-3933-01 50 μL

IL31 Antibody

Sign In for Pricing
View Details
IL31 Antibody
KC-3933-02 100 µL

IL31 Antibody

Sign In for Pricing
View Details
IL31 Antibody
KC-3933-03 1 mL

IL31 Antibody

Sign In for Pricing
View Details
EFEMP2 (NM_016938) Human Over-expression Lysate
LY402585 100 µg

EFEMP2 (NM_016938) Human Over-expression Lysate

Sign In for Pricing
View Details
SNAP-beta (NAPB) (NM_022080) Human Recombinant Protein
TP309278M 100 µg

SNAP-beta (NAPB) (NM_022080) Human Recombinant Protein

Sign In for Pricing
View Details
Diacetoxyscirpenol
TRC-D307550-1MG 1 mg

Diacetoxyscirpenol

Sign In for Pricing
View Details