Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis ATP synthase subunit b (atpF)

This Recombinant Mycobacterium bovis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A1KI94

Expression Region

1-171

Origin

Mycobacterium bovis (strain BCG / Pasteur 1173P2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEVSAIVLAASQAAEEGGESSNFLIPNGTFFVVLAIFLVVLAVIGTFVVPPILKVLRER DAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARADGRKVIEDARVRAEQ QVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGVDLTASAATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (Melanoma Marker) (rOCA1/812), CF488A conjugate, 0.1mg/mL
BNC882215-100 1x 100 µL

Tyrosinase (Melanoma Marker) (rOCA1/812), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse Sele Protein (His Tag)
PDMM100051-01 20 µg

Recombinant Mouse Sele Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Sele Protein (His Tag)
PDMM100051-02 100 µg

Recombinant Mouse Sele Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Sele Protein (His Tag)
PDMM100051-03 500 µg

Recombinant Mouse Sele Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Sele Protein (His Tag)
PDMM100051-04 1 mg

Recombinant Mouse Sele Protein (His Tag)

Sign In for Pricing
View Details
STAT4 Rabbit Polyclonal Antibody
AP02588PU-S 50 µL

STAT4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details