Recombinant Mycobacterium gilvum ATP synthase subunit b (atpF)
This Recombinant Mycobacterium gilvum ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
A4T8K9
Expression Region
1-171
Origin
Mycobacterium gilvum (strain PYR-GCK) (Mycobacterium flavescens (strain ATCC 700033 / PYR-GCK) )
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGDLTSTNLASAILAAEEGGGTSNFLLPNGTFFAVLLIFLIVLGVIAKWVVPPISKVLAE REAMLAKTAADNRKSAEQVAAARADYDKTLAEARGEASSIRDEARVAGRQVVDEKRATAN GEVAETVKTADEKLTQQGSAAQSELQSSVDALSATLASRILGVDVNTRGSQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
FMC31014 100 Tests
Anti-Mouse CD243/P-Glycoprotein Antibody (SAA0482), PerCP
Sign In for Pricing
View Details 
abx302993-01 20 µg
Activin A Receptor Type 1B (ACVR1B) Antibody (FITC)
Sign In for Pricing
View Details