Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

This Recombinant Synechococcus sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A5GV74

Expression Region

1-171

Origin

Synechococcus sp. (strain RCC307)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSLPFVLANHGFALNFNVFETNLINLVLVIALLVYFLKGFLGGILERRREAILADLKD AEERLVTASKALEEGQRELAQAKSTAEKILAEAKQRADLIREDGEKRTIEEMARIKQDAN ANLNAEAARVIEALRAETARTAIDKALAALPKRLNDAKRAELIDRSIEALG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Autoclave & Incubator Rack
R3015 Inquire

Autoclave & Incubator Rack

Sign In for Pricing
View Details
Socazolimab Human Monoclonal Antibody
orb2977802-01 100 µg

Socazolimab Human Monoclonal Antibody

Sign In for Pricing
View Details
Socazolimab Human Monoclonal Antibody
orb2977802-02 1 mg

Socazolimab Human Monoclonal Antibody

Sign In for Pricing
View Details
1-Bromo-3- (tert-butoxy) benzene
OR47857-01 250 mg

1-Bromo-3- (tert-butoxy) benzene

Sign In for Pricing
View Details
1-Bromo-3- (tert-butoxy) benzene
OR47857-02 1 g

1-Bromo-3- (tert-butoxy) benzene

Sign In for Pricing
View Details
LILRA4 (Daxdilimab Biosimilar)
591782-01 100 µg

LILRA4 (Daxdilimab Biosimilar)

Sign In for Pricing
View Details