Recombinant Mycobacterium tuberculosis ATP synthase subunit b (atpF)
This Recombinant Mycobacterium tuberculosis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
A5U205
Expression Region
1-171
Origin
Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGEVSAIVLAASQAAEEGGESSNFLIPNGTFFVVLAIFLVVLAVIGTFVVPPILKVLRER DAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARADGRKVIEDARVRAEQ QVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGVDLTASAATR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
10-101-F-25 25 µg
Mouse IgG1 Isotype Control (Clone: MOPC31C) - FITC
Sign In for Pricing
View Details 
TRC-P840145-250MG 250 mg
Pseudotropine 4-Fluorobenzoate Hydrochloride
Sign In for Pricing
View Details 
LY402753 100 µg
SAR1 (SAR1A) (NM_020150) Human Over-expression Lysate
Sign In for Pricing
View Details 