Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis ATP synthase subunit b (atpF)

This Recombinant Mycobacterium tuberculosis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A5U205

Expression Region

1-171

Origin

Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEVSAIVLAASQAAEEGGESSNFLIPNGTFFVVLAIFLVVLAVIGTFVVPPILKVLRER DAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARADGRKVIEDARVRAEQ QVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGVDLTASAATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTau396 Antibody
KC-12463-01 50 μL

PTau396 Antibody

Sign In for Pricing
View Details
PTau396 Antibody
KC-12463-02 100 µL

PTau396 Antibody

Sign In for Pricing
View Details
PTau396 Antibody
KC-12463-03 1 mL

PTau396 Antibody

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF640R conjugate, 0.1mg/mL
BNC402363-100 1x 100 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TSTD1 (NM_001113205) Human Over-expression Lysate
LY426391 100 µg

TSTD1 (NM_001113205) Human Over-expression Lysate

Sign In for Pricing
View Details
L-Idose-1-13C (0.16M Aqueous Solution)
TRC-I175062-50MG 50 mg

L-Idose-1-13C (0.16M Aqueous Solution)

Sign In for Pricing
View Details