Recombinant Caulobacter sp. ATP synthase subunit b (atpF)
This Recombinant Caulobacter sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
B0T010
Expression Region
1-171
Origin
Caulobacter sp. (strain K31)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPAFFEGEFWQIANPELWVGVGLILFIAIVIWAKAPAMIAGKLDETAAKIQTDLDEAARI RAEAEALLATIRAEREETERQAIAMLAAAKADVAQMEIEAKAKLEDQIKRRAEMAERKIA QSEAQAQADVKAAAVDLAAQIAEQVLMARLAAGGSDGLVDTAIGQIGAKLQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![1,1'-Diisooctyl Ester 2,2'-[(Dioctylstannylene)bis(thio)]bis-acetic Acid (Technical Grade)](https://cdn.genprice.uk/products/572/4504981861054/imageurl/trc-d638870-1g.webp)
TRC-D638870-1G 1 g
1,1'-Diisooctyl Ester 2,2'-[(Dioctylstannylene)bis(thio)]bis-acetic Acid (Technical Grade)
Sign In for Pricing
View Details 
LY419184 100 µg
PI 3 Kinase catalytic subunit gamma (PIK3CG) (NM_002649) Human Over-expression Lysate
Sign In for Pricing
View Details 
E-CL-M0376-01 24 Tests
Mouse HSP-90 (Heat Shock Protein 90) CLIA Kit
Sign In for Pricing
View Details