Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Caulobacter sp. ATP synthase subunit b (atpF)

This Recombinant Caulobacter sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B0T010

Expression Region

1-171

Origin

Caulobacter sp. (strain K31)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPAFFEGEFWQIANPELWVGVGLILFIAIVIWAKAPAMIAGKLDETAAKIQTDLDEAARI RAEAEALLATIRAEREETERQAIAMLAAAKADVAQMEIEAKAKLEDQIKRRAEMAERKIA QSEAQAQADVKAAAVDLAAQIAEQVLMARLAAGGSDGLVDTAIGQIGAKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Nose
CS501262 5x 5 µm

Frozen Tissue Sections, Nose

Sign In for Pricing
View Details
2-Ethoxy-6,9-diaminoacridine Lactate
TRC-E261505-1G 1 g

2-Ethoxy-6,9-diaminoacridine Lactate

Sign In for Pricing
View Details
Sex Hormone Binding Globulin (SHBG) (N-term) Rabbit Polyclonal Antibody
AP53907PU-N 400 µL

Sex Hormone Binding Globulin (SHBG) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Ift27 activation kit by CRISPRa
GA207103 1 Kit

Mouse Ift27 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS704419 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human LRP5L activation kit by CRISPRa
GA114105 1 Kit

Human LRP5L activation kit by CRISPRa

Sign In for Pricing
View Details