Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactate dehydrogenase-elevating virus Protein X (VPX)

This Recombinant Lactate dehydrogenase-elevating virus Protein X (VPX) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

Protein X, Envelope protein, VpX

UniProt

P0C781

Expression Region

1-171

Origin

Lactate dehydrogenase-elevating virus (LDV)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGLEFCDQTSWYQIFIAFSLTYTPIAIYSLKVFRGTLAGIVNIFIFINCCVSFVYLMYH HSVTNTIALSLGAVIALVWGIYTLVKIVDWLVIRCRLCFLGRSYILAPPSHVDTSDGRQS LTTSLTTAFVVRKPGSTLVNGQLVPDFQRLVLGGKKAVSKGAVNLLKYVSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITIH5 Protein (N-His, Human)
P505286 100 µg

ITIH5 Protein (N-His, Human)

Sign In for Pricing
View Details
pDEST14 Plasmid
PVT29216 2 µg

pDEST14 Plasmid

Sign In for Pricing
View Details
PMPCB ORF Vector (Human) (pORF)
37072011 1.0 µg DNA

PMPCB ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ProBNP Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-5145R-BF405 100 µL

ProBNP Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Rabbit anti-GNL2 Antibody, Affinity Purified
A305-155A 100 µg

Rabbit anti-GNL2 Antibody, Affinity Purified

Sign In for Pricing
View Details
Trhr2 (NM_133202) Mouse Tagged ORF Clone Lentiviral Particle
MR215463L4V 200 µL

Trhr2 (NM_133202) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details