Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactate dehydrogenase-elevating virus Protein X (VPX)

This Recombinant Lactate dehydrogenase-elevating virus Protein X (VPX) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

Protein X, Envelope protein, VpX

UniProt

P0C781

Expression Region

1-171

Origin

Lactate dehydrogenase-elevating virus (LDV)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGLEFCDQTSWYQIFIAFSLTYTPIAIYSLKVFRGTLAGIVNIFIFINCCVSFVYLMYH HSVTNTIALSLGAVIALVWGIYTLVKIVDWLVIRCRLCFLGRSYILAPPSHVDTSDGRQS LTTSLTTAFVVRKPGSTLVNGQLVPDFQRLVLGGKKAVSKGAVNLLKYVSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2H2C_2 Rabbit pAb
E45R28096N-50 50 µL

GTF2H2C_2 Rabbit pAb

Sign In for Pricing
View Details
Nom1 Mouse shRNA Lentiviral Particle (Locus ID 433864)
TL515761V 500 µL Each

Nom1 Mouse shRNA Lentiviral Particle (Locus ID 433864)

Sign In for Pricing
View Details
Recombinant Salt Inducible Kinase 2 (SIK2)
TRV-0012494-01 10 µg

Recombinant Salt Inducible Kinase 2 (SIK2)

Sign In for Pricing
View Details
Recombinant Salt Inducible Kinase 2 (SIK2)
TRV-0012494-02 50 µg

Recombinant Salt Inducible Kinase 2 (SIK2)

Sign In for Pricing
View Details
Recombinant Salt Inducible Kinase 2 (SIK2)
TRV-0012494-03 100 µg

Recombinant Salt Inducible Kinase 2 (SIK2)

Sign In for Pricing
View Details
Recombinant Salt Inducible Kinase 2 (SIK2)
TRV-0012494-04 200 µg

Recombinant Salt Inducible Kinase 2 (SIK2)

Sign In for Pricing
View Details