Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope protein UL45 (UL45)

This Recombinant Human herpesvirus 2 Envelope protein UL45 (UL45) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Envelope protein UL45, 18 kDa protein

UniProt

P06483

Expression Region

1-172

Origin

Human herpesvirus 2 (strain 333) (HHV-2) (Human herpes simplex virus 2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFRASGPAYQPLAPAASPARARVPAVAWIGVGAIVGAFALVAALVLVPPRSSWGLSPCD SGWQEFNAGCVAWDPTPVEHEQAVGGCSAPATLIPRAAAKHLAALTRVQAERSSGYWWVN GDGIRTCLRLVDSVSGIDEFCEELAIRICYYPRSPGGFVRFVTSIRNALGLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK2 (bovine) -PR
sc-270339-PR 10 µM - 20 µL

JNK2 (bovine) -PR

Sign In for Pricing
View Details
pCR4-TOPO-FAM110D Plasmid
PVT20075 2 µg

pCR4-TOPO-FAM110D Plasmid

Sign In for Pricing
View Details
SGTA (Small Glutamine-rich Tetratricopeptide Repeat-containing Protein alpha, Alpha-SGT, Vpu-binding protein, UBP, SGT, SGT1) (MaxLight 550)
133277-ML550 100 µL

SGTA (Small Glutamine-rich Tetratricopeptide Repeat-containing Protein alpha, Alpha-SGT, Vpu-binding protein, UBP, SGT, SGT1) (MaxLight 550)

Sign In for Pricing
View Details
Porcine Cystatin 3 (CST3) ELISA Kit
MBS2023630-01 24 Strip Well

Porcine Cystatin 3 (CST3) ELISA Kit

Sign In for Pricing
View Details
Porcine Cystatin 3 (CST3) ELISA Kit
MBS2023630-02 48 Well

Porcine Cystatin 3 (CST3) ELISA Kit

Sign In for Pricing
View Details
Porcine Cystatin 3 (CST3) ELISA Kit
MBS2023630-03 96 Well

Porcine Cystatin 3 (CST3) ELISA Kit

Sign In for Pricing
View Details