Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnaporthe oryzae Signal peptidase complex catalytic subunit SEC11 (SEC11)

This Recombinant Magnaporthe oryzae Signal peptidase complex catalytic subunit SEC11 (SEC11) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

Signal peptidase complex catalytic subunit SEC11, EC= 3.4.21.89, Signal peptidase I

UniProt

A4RGA1

Expression Region

1-172

Origin

Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSSLGNPRQAATQLLNFALILSTAFMMWKGLSVATDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNIVQETDVGEIVVYNVKGKDIPIVHRIVRKFGAGPKAKLLTKGDNNAADDTELYA KDQDYLERKDIIGSVVAYIPFVGYVTIMLSEHPWMKTAMLGIMGLMVVLQRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-100 1x 100 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-500 1x 500 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-100 1x 100 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details