Recombinant Nectria haematococca Signal peptidase complex catalytic subunit SEC11 (SEC11)
This Recombinant Nectria haematococca Signal peptidase complex catalytic subunit SEC11 (SEC11) spans the amino acid sequence from region 1-172.
Product Specifications
Product Name Alternative
Signal peptidase complex catalytic subunit SEC11, EC= 3.4.21.89, Signal peptidase I
UniProt
C7ZHK5
Expression Region
1-172
Origin
Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLSSLGNPRQAAAQLMNFALILSTAFMMWKGLSVITDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNLLRETEVGEVVVYNVKDKDIPIVHRVVRKFGNGDTAELLTKGDNNLSDDTELYA KGQDYLERKDIIGSVVAYMPFVGYVTILLSEHPWLKTVMLGIMGLLVVLQRE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941014-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (2F6), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP50830PU-N 400 µL
TCP1 theta (CCT8) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
ICH1044-5mg 5 mg
Anti-Mouse CD8a (53-6.7) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details 