Recombinant Nectria haematococca Signal peptidase complex catalytic subunit SEC11 (SEC11)
This Recombinant Nectria haematococca Signal peptidase complex catalytic subunit SEC11 (SEC11) spans the amino acid sequence from region 1-172.
Product Specifications
Product Name Alternative
Signal peptidase complex catalytic subunit SEC11, EC= 3.4.21.89, Signal peptidase I
UniProt
C7ZHK5
Expression Region
1-172
Origin
Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLSSLGNPRQAAAQLMNFALILSTAFMMWKGLSVITDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNLLRETEVGEVVVYNVKDKDIPIVHRVVRKFGNGDTAELLTKGDNNLSDDTELYA KGQDYLERKDIIGSVVAYMPFVGYVTILLSEHPWLKTVMLGIMGLLVVLQRE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-0054-01 24 Tests
6-keto-PGF1a (6-keto-prostaglandin F1a) ELISA Kit
Sign In for Pricing
View Details E-EL-0054-02 48 Tests
6-keto-PGF1a (6-keto-prostaglandin F1a) ELISA Kit
Sign In for Pricing
View Details E-EL-0054-03 96 Tests
6-keto-PGF1a (6-keto-prostaglandin F1a) ELISA Kit
Sign In for Pricing
View Details 
E-BC-K168-M-01 96 T (80 samples)
Bradford Protein Colorimetric Assay Kit
Sign In for Pricing
View Details 